Lineage for d5yifb1 (5yif B:1-467)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. Protein automated matches [190075] (131 species)
    not a true protein
  7. Species Bacillus sp. [TaxId:1409] [356870] (6 PDB entries)
  8. Domain d5yifb1: 5yif B:1-467 [356874]
    Other proteins in same PDB: d5yifa2, d5yifb2
    automated match to d5oked_
    complexed with 8vr; mutant

Details for d5yifb1

PDB Entry: 5yif (more details), 2.4499999999999997 Å

PDB Description: pyruvylated beta-d-galactosidase from bacillus sp. hma207, e163a mutant pyruvylated beta-d-galactose complex
PDB Compounds: (B:) Pyruvylated beta-D-galactosidase

SCOPe Domain Sequences for d5yifb1:

Sequence, based on SEQRES records: (download)

>d5yifb1 c.1.8.0 (B:1-467) automated matches {Bacillus sp. [TaxId: 1409]}
mkfphdflfgaasasyqvegawnedgkgvtnwdefskipgktyngtngdiavdhyhryke
dvrlmaemglesyrfsiswarilptgdgkvnekgiefynnlideclkygivpfvtlyhwd
lplplekdggwtnkrtaeafvkyaetcfkafgdrvkhwitfnatvmfcglgylkgahppg
iqndvpkyfqathyvfyahaktvavykqlkqygeigithvflpaysvddqkeniqaanha
neyetywyydpilkgeypsyvvqqlkekgwtpnwtveeleiikqnaeendfiglnyyqpi
rverydmdikseehsrenstlapgnpsfdgfyrtvkmddktytkwgweispegfleglhm
lkarygdikmyvtenglgdedpiidgeivdvprikfieahlkvmkraieeginlkgyyaw
svidllswlngykkqygfifvdhndnlkrkkklsfhwykrvvetrge

Sequence, based on observed residues (ATOM records): (download)

>d5yifb1 c.1.8.0 (B:1-467) automated matches {Bacillus sp. [TaxId: 1409]}
mkfphdflfgaasasyqvegawnedgkgvtnwdefskipgktyngtngdiavdhyhryke
dvrlmaemglesyrfsiswarilptgdgkvnekgiefynnlideclkygivpfvtlyhwd
lplplekdggwtnkrtaeafvkyaetcfkafgdrvkhwitfnatvmfcglgylkgahppg
iqndvpkyfqathyvfyahaktvavykqlkqygeigithvflpaysvddqkeniqaanha
neyetywyydpilkgeypsyvvqqlkekgwtpnwtveeleiikqnaeendfiglnyyqpi
rverydmdiklapgnpsfdgfyrtvkmddktytkwgweispegfleglhmlkarygdikm
yvtenglgdedpiidgeivdvprikfieahlkvmkraieeginlkgyyawsvidllswln
gykkqygfifvdhndnlkrkkklsfhwykrvvetrge

SCOPe Domain Coordinates for d5yifb1 are not available.

Timeline for d5yifb1:

Domains from same chain:
(mouse over for more information)
d5yifb2
Domains from other chains:
(mouse over for more information)
d5yifa1, d5yifa2