Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) |
Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins) |
Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
Species Escherichia coli [TaxId:562] [53838] (8 PDB entries) |
Domain d1tlfa_: 1tlf A: [35687] |
PDB Entry: 1tlf (more details), 2.6 Å
SCOP Domain Sequences for d1tlfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlfa_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli} slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl
Timeline for d1tlfa_: