SCOPe 2.08: Domain d5opda1: 5opd A:11-205

Lineage for d5opda1 (5opd A:11-205)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Escherichia coli [TaxId:331112] [343069] (2 PDB entries)

8. Domain d5opda1: 5opd A:11-205 [356864]
   Other proteins in same PDB: d5opda2, d5opda3, d5opdb2, d5opdb3
   automated match to d1d8ta3
   complexed with gol, gtp, iod, mg, na

Details for d5opda1

PDB Entry: 5opd, 2.75 Å

PDB Description: structure of phosphorylated ef-tu in complex with gtp

PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d5opda1:

Sequence, based on SEQRES records:

>d5opda1 c.37.1.8 (A:11-205) automated matches {Escherichia coli [TaxId: 331112]}
phvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshvey
dtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpy
iivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakil
elagfldsyipeper

Sequence, based on observed residues (ATOM records):

>d5opda1 c.37.1.8 (A:11-205) automated matches {Escherichia coli [TaxId: 331112]}
phvnvgtighvdhgkttltaaittvlaktyggarafdqidnapeitintshveydtptrh
yahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivfln
kcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfl
dsyipeper

Timeline for d5opda1:

• d5opda1 first appeared in SCOPe 2.07