SCOPe 2.07: Domain d5xqzb1: 5xqz B:33-216

Lineage for d5xqzb1 (5xqz B:33-216)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.7: Mob1/phocein [101152] (2 families)
   common fold is elaborated with additional short helices; contains a zinc-binding site
   automatically mapped to Pfam PF03637

5. Family a.29.7.1: Mob1/phocein [101153] (2 proteins)

6. Protein automated matches [319235] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries)

8. Domain d5xqzb1: 5xqz B:33-216 [356854]
   Other proteins in same PDB: d5xqzb2
   automated match to d1pi1a_
   complexed with gol, zn

Details for d5xqzb1

PDB Entry: 5xqz, 2.1 Å

PDB Description: structure of the mob1-ndr2 complex

PDB Compounds: (B:) MOB kinase activator 1A

SCOPe Domain Sequences for d5xqzb1:

Sequence; same for both SEQRES and ATOM records:

>d5xqzb1 a.29.7.1 (B:33-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagpr
yeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktil
krlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklg
skdr

Timeline for d5xqzb1:

• d5xqzb1 is new in SCOPe 2.07-stable
  
• d5xqzb1 appears in the current release, SCOPe 2.08