Lineage for d6hg5a_ (6hg5 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417090Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2417103Protein Influenza neuraminidase [50943] (8 species)
  7. 2417137Species Influenza a virus (strain a/duck/england/1/1956 h11n6) [TaxId:383550] [356823] (3 PDB entries)
  8. 2417142Domain d6hg5a_: 6hg5 A: [356834]
    automated match to d1v0za_
    complexed with bma, ca, co2, g39, gol, man, nag

Details for d6hg5a_

PDB Entry: 6hg5 (more details), 1.6 Å

PDB Description: influenza a virus n6 neuraminidase complex with oseltamivir (duck/england/56).
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d6hg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hg5a_ b.68.1.1 (A:) Influenza neuraminidase {Influenza a virus (strain a/duck/england/1/1956 h11n6) [TaxId: 383550]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d6hg5a_:

Click to download the PDB-style file with coordinates for d6hg5a_.
(The format of our PDB-style files is described here.)

Timeline for d6hg5a_: