Lineage for d6hcxa_ (6hcx A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. Protein Influenza neuraminidase [50943] (9 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. Domain d6hcxa_: 6hcx A: [356831]
    automated match to d1f8da_
    complexed with ca, gol, k, zmr

Details for d6hcxa_

PDB Entry: 6hcx (more details), 1.3 Å

PDB Description: influenza virus n9 neuraminidase a complex with zanamivir molecule (tern).
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d6hcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hcxa_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOPe Domain Coordinates for d6hcxa_ are not available.

Timeline for d6hcxa_: