Lineage for d6gd8a1 (6gd8 A:-4-103)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
    Uniprot P00044
  8. 2691140Domain d6gd8a1: 6gd8 A:-4-103 [356825]
    Other proteins in same PDB: d6gd8a2, d6gd8b2, d6gd8c2, d6gd8d2
    automated match to d5t8wa_
    complexed with evb, hec

Details for d6gd8a1

PDB Entry: 6gd8 (more details), 2.5 Å

PDB Description: cytochrome c in complex with sulfonato-calix[8]arene, p31 form
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d6gd8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gd8a1 a.3.1.1 (A:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d6gd8a1:

Click to download the PDB-style file with coordinates for d6gd8a1.
(The format of our PDB-style files is described here.)

Timeline for d6gd8a1: