SCOPe 2.08: Domain d6gd8b1: 6gd8 B:-4-103

Lineage for d6gd8b1 (6gd8 B:-4-103)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
   Uniprot P00044

8. Domain d6gd8b1: 6gd8 B:-4-103 [356793]
   Other proteins in same PDB: d6gd8a2, d6gd8b2, d6gd8c2, d6gd8d2
   automated match to d5t8wa_
   complexed with evb, hec

Details for d6gd8b1

PDB Entry: 6gd8, 2.5 Å

PDB Description: cytochrome c in complex with sulfonato-calix[8]arene, p31 form

PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d6gd8b1:

Sequence; same for both SEQRES and ATOM records:

>d6gd8b1 a.3.1.1 (B:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d6gd8b1:

• d6gd8b1 first appeared in SCOPe 2.07