Lineage for d2puba2 (2pub A:59-340)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878508Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 1878692Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 1878693Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 1878700Domain d2puba2: 2pub A:59-340 [35679]
    Other proteins in same PDB: d2puba1
    protein/DNA complex; complexed with ade

Details for d2puba2

PDB Entry: 2pub (more details), 2.7 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
PDB Compounds: (A:) purine repressor

SCOPe Domain Sequences for d2puba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2puba2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

SCOPe Domain Coordinates for d2puba2:

Click to download the PDB-style file with coordinates for d2puba2.
(The format of our PDB-style files is described here.)

Timeline for d2puba2: