Lineage for d6h23k_ (6h23 K:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460579Protein Clp protease, ClpP subunit [52098] (10 species)
  7. 2460667Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (3 PDB entries)
    Uniprot Q16740 57-249
  8. 2460692Domain d6h23k_: 6h23 K: [356787]
    automated match to d1tg6e_
    complexed with edo, fjt; mutant

Details for d6h23k_

PDB Entry: 6h23 (more details), 3.09 Å

PDB Description: crystal structure of the hclpp y118a mutant with an activating small molecule
PDB Compounds: (K:) ATP-dependent Clp protease proteolytic subunit, mitochondrial

SCOPe Domain Sequences for d6h23k_:

Sequence, based on SEQRES records: (download)

>d6h23k_ c.14.1.1 (K:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggargqatdia
iqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp

Sequence, based on observed residues (ATOM records): (download)

>d6h23k_ c.14.1.1 (K:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
ydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglai
ydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpiaiqaeeimklk
kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp

SCOPe Domain Coordinates for d6h23k_:

Click to download the PDB-style file with coordinates for d6h23k_.
(The format of our PDB-style files is described here.)

Timeline for d6h23k_: