SCOPe 2.07: Domain d6ggra1: 6ggr A:20-186

Lineage for d6ggra1 (6ggr A:20-186)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein automated matches [254629] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255600] (3 PDB entries)

8. Domain d6ggra1: 6ggr A:20-186 [356775]
   Other proteins in same PDB: d6ggra2
   automated match to d1bvoa_
   complexed with cl

Details for d6ggra1

PDB Entry: 6ggr, 2.1 Å

PDB Description: crystal structure of salmonella zinc metalloprotease effector gtga in complex with p65

PDB Compounds: (A:) Transcription factor p65

SCOPe Domain Sequences for d6ggra1:

Sequence; same for both SEQRES and ATOM records:

>d6ggra1 b.2.5.3 (A:20-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnnn
pfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdn

Timeline for d6ggra1:

• d6ggra1 is new in SCOPe 2.07-stable
  
• d6ggra1 appears in the current release, SCOPe 2.08