Lineage for d6ggra1 (6ggr A:20-186)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768236Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2768260Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2768267Species Mouse (Mus musculus) [TaxId:10090] [49429] (9 PDB entries)
  8. 2768271Domain d6ggra1: 6ggr A:20-186 [356775]
    Other proteins in same PDB: d6ggra2
    automated match to d1bvoa_
    complexed with cl

Details for d6ggra1

PDB Entry: 6ggr (more details), 2.1 Å

PDB Description: crystal structure of salmonella zinc metalloprotease effector gtga in complex with p65
PDB Compounds: (A:) Transcription factor p65

SCOPe Domain Sequences for d6ggra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ggra1 b.2.5.3 (A:20-186) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnnn
pfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdn

SCOPe Domain Coordinates for d6ggra1:

Click to download the PDB-style file with coordinates for d6ggra1.
(The format of our PDB-style files is described here.)

Timeline for d6ggra1: