Lineage for d6g4pb_ (6g4p B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507027Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2507362Protein automated matches [190065] (7 species)
    not a true protein
  7. 2507614Species Tetronarce californica [TaxId:7787] [350659] (10 PDB entries)
  8. 2507632Domain d6g4pb_: 6g4p B: [356763]
    automated match to d2xugb_
    complexed with cl, elt, jds, nag, pg4

Details for d6g4pb_

PDB Entry: 6g4p (more details), 2.83 Å

PDB Description: non-aged form of torpedo californica acetylcholinesterase inhibited by tabun analog nedpa bound to uncharged reactivator 2
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d6g4pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g4pb_ c.69.1.1 (B:) automated matches {Tetronarce californica [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d6g4pb_:

Click to download the PDB-style file with coordinates for d6g4pb_.
(The format of our PDB-style files is described here.)

Timeline for d6g4pb_: