Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein automated matches [190065] (7 species) not a true protein |
Species Tetronarce californica [TaxId:7787] [350659] (10 PDB entries) |
Domain d6g4pb_: 6g4p B: [356763] automated match to d2xugb_ complexed with cl, elt, jds, nag, pg4 |
PDB Entry: 6g4p (more details), 2.83 Å
SCOPe Domain Sequences for d6g4pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g4pb_ c.69.1.1 (B:) automated matches {Tetronarce californica [TaxId: 7787]} sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
Timeline for d6g4pb_: