Lineage for d1qp7a2 (1qp7 A:59-340)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520498Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 2520499Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 2520521Domain d1qp7a2: 1qp7 A:59-340 [35676]
    Other proteins in same PDB: d1qp7a1
    protein/DNA complex; complexed with hpa; mutant

Details for d1qp7a2

PDB Entry: 1qp7 (more details), 2.9 Å

PDB Description: purine repressor mutant-hypoxanthine-palindromic operator complex
PDB Compounds: (A:) protein (purine nucleotide synthesis repressor)

SCOPe Domain Sequences for d1qp7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp7a2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

SCOPe Domain Coordinates for d1qp7a2:

Click to download the PDB-style file with coordinates for d1qp7a2.
(The format of our PDB-style files is described here.)

Timeline for d1qp7a2: