Lineage for d6fqua_ (6fqu A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. Protein CREB-binding protein, CBP [74712] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [74713] (58 PDB entries)
  8. Domain d6fqua_: 6fqu A: [356756]
    automated match to d4nyxa_
    complexed with e3b

Details for d6fqua_

PDB Entry: 6fqu (more details), 1.43 Å

PDB Description: crystal structure of crebbp bromodomain complexd with dr09
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d6fqua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fqua_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrk
ldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d6fqua_ are not available.

Timeline for d6fqua_: