![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins) |
![]() | Protein Purine repressor (PurR), C-terminal domain [53835] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53836] (24 PDB entries) |
![]() | Domain d1qqaa2: 1qqa A:59-340 [35675] Other proteins in same PDB: d1qqaa1 protein/DNA complex; complexed with hpa; mutant |
PDB Entry: 1qqa (more details), 3 Å
SCOP Domain Sequences for d1qqaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqaa2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr
Timeline for d1qqaa2: