Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Kluyveromyces lactis [TaxId:284590] [356724] (2 PDB entries) |
Domain d6efha2: 6efh A:182-360 [356744] Other proteins in same PDB: d6efha1, d6efha3, d6efhb1, d6efhb3 automated match to d2vk4a2 complexed with 1pe, mg, py0, tpp |
PDB Entry: 6efh (more details), 2.99 Å
SCOPe Domain Sequences for d6efha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6efha2 c.31.1.0 (A:182-360) automated matches {Kluyveromyces lactis [TaxId: 284590]} dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
Timeline for d6efha2: