| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Kluyveromyces lactis [TaxId:284590] [356722] (2 PDB entries) |
| Domain d6efha1: 6efh A:2-181 [356743] Other proteins in same PDB: d6efha2, d6efhb2 automated match to d2vk4a1 complexed with 1pe, mg, py0, tpp |
PDB Entry: 6efh (more details), 2.99 Å
SCOPe Domain Sequences for d6efha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6efha1 c.36.1.0 (A:2-181) automated matches {Kluyveromyces lactis [TaxId: 284590]}
seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy
arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgngd
ftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll
Timeline for d6efha1: