Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) automatically mapped to Pfam PF01179 |
Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
Protein automated matches [356739] (2 species) not a true protein |
Species Escherichia coli [TaxId:83333] [356740] (1 PDB entry) |
Domain d6ezzb4: 6ezz B:301-725 [356741] Other proteins in same PDB: d6ezza1, d6ezza2, d6ezza3, d6ezzb1, d6ezzb2, d6ezzb3 automated match to d1oaca1 complexed with ca, cu, gol; mutant |
PDB Entry: 6ezz (more details), 1.8 Å
SCOPe Domain Sequences for d6ezzb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ezzb4 b.30.2.1 (B:301-725) automated matches {Escherichia coli [TaxId: 83333]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynignqqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galkk
Timeline for d6ezzb4:
View in 3D Domains from other chains: (mouse over for more information) d6ezza1, d6ezza2, d6ezza3, d6ezza4 |