SCOPe 2.08: Domain d1qqba2: 1qqb A:59-340

Lineage for d1qqba2 (1qqb A:59-340)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)

7. Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)

8. Domain d1qqba2: 1qqb A:59-340 [35674]
   Other proteins in same PDB: d1qqba1
   protein/DNA complex; complexed with hpa; mutant

Details for d1qqba2

PDB Entry: 1qqb, 2.7 Å

PDB Description: purine repressor mutant-hypoxanthine-palindromic operator complex

PDB Compounds: (A:) purine nucleotide synthesis repressor

SCOPe Domain Sequences for d1qqba2:

Sequence; same for both SEQRES and ATOM records:

>d1qqba2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

Timeline for d1qqba2:

• d1qqba2 first appeared (with stable ids) in SCOP 1.55
  
• d1qqba2 appears in SCOPe 2.07