Lineage for d6ezzb1 (6ezz B:6-90)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568896Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2568897Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) (S)
    automatically mapped to Pfam PF07833
  5. 2568933Family d.82.1.0: automated matches [356730] (1 protein)
    not a true family
  6. 2568934Protein automated matches [356731] (2 species)
    not a true protein
  7. 2568938Species Escherichia coli [TaxId:83333] [356732] (1 PDB entry)
  8. 2568940Domain d6ezzb1: 6ezz B:6-90 [356733]
    Other proteins in same PDB: d6ezza2, d6ezza3, d6ezza4, d6ezzb2, d6ezzb3, d6ezzb4
    automated match to d1d6za4
    complexed with ca, cu, gol; mutant

Details for d6ezzb1

PDB Entry: 6ezz (more details), 1.8 Å

PDB Description: crystal structure of escherichia coli amine oxidase mutant e573q
PDB Compounds: (B:) primary amine oxidase

SCOPe Domain Sequences for d6ezzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezzb1 d.82.1.0 (B:6-90) automated matches {Escherichia coli [TaxId: 83333]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d6ezzb1:

Click to download the PDB-style file with coordinates for d6ezzb1.
(The format of our PDB-style files is described here.)

Timeline for d6ezzb1: