![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) ![]() automatically mapped to Pfam PF07833 |
![]() | Family d.82.1.0: automated matches [356730] (1 protein) not a true family |
![]() | Protein automated matches [356731] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [356732] (1 PDB entry) |
![]() | Domain d6ezzb1: 6ezz B:6-90 [356733] Other proteins in same PDB: d6ezza2, d6ezza3, d6ezza4, d6ezzb2, d6ezzb3, d6ezzb4 automated match to d1d6za4 complexed with ca, cu, gol; mutant |
PDB Entry: 6ezz (more details), 1.8 Å
SCOPe Domain Sequences for d6ezzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ezzb1 d.82.1.0 (B:6-90) automated matches {Escherichia coli [TaxId: 83333]} hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd nkawvsdtfindvfqsgldqtfqve
Timeline for d6ezzb1:
![]() Domains from other chains: (mouse over for more information) d6ezza1, d6ezza2, d6ezza3, d6ezza4 |