Lineage for d6ds6a_ (6ds6 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642222Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2642223Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2642363Family g.44.1.6: ZZ domain [161211] (4 proteins)
    Pfam PF00569
  6. 2642373Protein automated matches [317038] (1 species)
    not a true protein
  7. 2642374Species Human (Homo sapiens) [TaxId:9606] [317039] (2 PDB entries)
  8. 2642375Domain d6ds6a_: 6ds6 A: [356727]
    automated match to d2n1ab_
    complexed with cl, zn

Details for d6ds6a_

PDB Entry: 6ds6 (more details), 1.95 Å

PDB Description: crystal structure of p300 zz domain in complex with histone h3 peptide
PDB Compounds: (A:) Histone H3 peptide-Histone acetyltransferase p300 Chimeric protein

SCOPe Domain Sequences for d6ds6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ds6a_ g.44.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
artkqtqdrfvytcneckhhvetrwhctvcedydlcitcyntknhdhkmeklg

SCOPe Domain Coordinates for d6ds6a_:

Click to download the PDB-style file with coordinates for d6ds6a_.
(The format of our PDB-style files is described here.)

Timeline for d6ds6a_: