Lineage for d6aska_ (6ask A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448077Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2448126Family c.1.16.4: Ssud-like monoxygenases [82275] (3 proteins)
  6. 2448136Protein automated matches [356719] (1 species)
    not a true protein
  7. 2448137Species Bacillus subtilis [TaxId:224308] [356720] (2 PDB entries)
  8. 2448138Domain d6aska_: 6ask A: [356721]
    automated match to d1tvla_

Details for d6aska_

PDB Entry: 6ask (more details), 1.69 Å

PDB Description: crystal structure of apo flavin monooxygenase cmoj (earlier ytnj)
PDB Compounds: (A:) Putative monooxygenase MoxC

SCOPe Domain Sequences for d6aska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aska_ c.1.16.4 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
radfiqfgamihgvggttdgwrhpdvdpsastniefymkkaqtaekglfsfifiadglfi
seksiphflnrfepitilsalasvtkniglvgtfstsftepftisrqlmsldhisggrag
wnlvtspqegaarnhsksnlpehteryeiaqehldvvrglwnswehdafihnkktgqffd
qaklhrlnhkgkyfqvegplnigrskqgepvvfqagssetgrqfaaknadaifthsnsle
etkafyadvksraadegrdpssvrifpgispivadteeeaekkyrefaelipienavtyl
arffddydlsvypldepfpdigdvgknafqsttdrikreakarnltlrevaqemafprtl
figtpervaslietwfnaeaadgfivgsdipgtldafvekvipilqerglyrqdyrggtl
renlglgipq

SCOPe Domain Coordinates for d6aska_:

Click to download the PDB-style file with coordinates for d6aska_.
(The format of our PDB-style files is described here.)

Timeline for d6aska_: