Lineage for d1qp4a2 (1qp4 A:59-340)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28104Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 28105Species Escherichia coli [TaxId:562] [53836] (20 PDB entries)
  8. 28119Domain d1qp4a2: 1qp4 A:59-340 [35672]
    Other proteins in same PDB: d1qp4a1

Details for d1qp4a2

PDB Entry: 1qp4 (more details), 3 Å

PDB Description: purine repressor-hypoxanthine-palindromic operator complex
PDB Compounds: (A:) protein (purine nucleotide synthesis repressor)

SCOP Domain Sequences for d1qp4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp4a2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

SCOP Domain Coordinates for d1qp4a2:

Click to download the PDB-style file with coordinates for d1qp4a2.
(The format of our PDB-style files is described here.)

Timeline for d1qp4a2: