Lineage for d6dr1a_ (6dr1 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. Protein automated matches [190252] (5 species)
    not a true protein
  7. Species Yersinia pestis [TaxId:632] [356707] (7 PDB entries)
  8. Domain d6dr1a_: 6dr1 A: [356708]
    automated match to d1pa9a_

Details for d6dr1a_

PDB Entry: 6dr1 (more details), 2.5 Å

PDB Description: yoph ptp1b chimera 2 ptpase
PDB Compounds: (A:) Targeted effector protein

SCOPe Domain Sequences for d6dr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dr1a_ c.45.1.2 (A:) automated matches {Yersinia pestis [TaxId: 632]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvttwpdfgvpesevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d6dr1a_ are not available.

Timeline for d6dr1a_: