SCOPe 2.07: Domain d6cwtd1: 6cwt D:2-108

Lineage for d6cwtd1 (6cwt D:2-108)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (28 PDB entries)

8. Domain d6cwtd1: 6cwt D:2-108 [356693]
   Other proteins in same PDB: d6cwtb2, d6cwtd2, d6cwte_, d6cwtf_
   automated match to d5tpnl1

Details for d6cwtd1

PDB Entry: 6cwt, 3.15 Å

PDB Description: hepatitis b core-antigen in complex with fab e21

PDB Compounds: (D:) Fab e21 light chain

SCOPe Domain Sequences for d6cwtd1:

Sequence; same for both SEQRES and ATOM records:

>d6cwtd1 b.1.1.0 (D:2-108) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elvmtqtpsstsaavggtvtincqasqsignalawyqqkpgqppkllisagsnlasgvps
rfrgsgsgteytltisdvqredaatyyclgtysaidrafgagtnvei

Timeline for d6cwtd1:

• d6cwtd1 is new in SCOPe 2.07-stable
  
• d6cwtd1 appears in the current release, SCOPe 2.08