SCOPe 2.07: Domain d6ckxd2: 6ckx D:158-259

Lineage for d6ckxd2 (6ckx D:158-259)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d6ckxd2: 6ckx D:158-259 [356691]
   automated match to d2i53a2
   complexed with 8m1, mg

Details for d6ckxd2

PDB Entry: 6ckx, 2.8 Å

PDB Description: structure of cdk12/cyck in complex with a small molecule inhibitor n- (4-(1-methyl-1h-pyrazol-4-yl)phenyl)-n-((1r,4r)-4-(quinazolin-2- ylamino)cyclohexyl)acetamide

PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d6ckxd2:

Sequence; same for both SEQRES and ATOM records:

>d6ckxd2 a.74.1.1 (D:158-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys

Timeline for d6ckxd2:

• d6ckxd2 is new in SCOPe 2.07-stable
  
• d6ckxd2 appears in the current release, SCOPe 2.08