Lineage for d6ckxd2 (6ckx D:158-259)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718557Protein automated matches [227027] (3 species)
    not a true protein
  7. 2718587Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2718633Domain d6ckxd2: 6ckx D:158-259 [356691]
    automated match to d2i53a2
    complexed with 8m1, mg

Details for d6ckxd2

PDB Entry: 6ckx (more details), 2.8 Å

PDB Description: structure of cdk12/cyck in complex with a small molecule inhibitor n- (4-(1-methyl-1h-pyrazol-4-yl)phenyl)-n-((1r,4r)-4-(quinazolin-2- ylamino)cyclohexyl)acetamide
PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d6ckxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ckxd2 a.74.1.1 (D:158-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys

SCOPe Domain Coordinates for d6ckxd2:

Click to download the PDB-style file with coordinates for d6ckxd2.
(The format of our PDB-style files is described here.)

Timeline for d6ckxd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ckxd1