SCOPe 2.08: Domain d6b3va1: 6b3v A:12-156

Lineage for d6b3va1 (6b3v A:12-156)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d6b3va1: 6b3v A:12-156 [356676]
   Other proteins in same PDB: d6b3va3
   automated match to d5e26a1
   complexed with 7dq, anp, edo, mg

Details for d6b3va1

PDB Entry: 6b3v, 1.6 Å

PDB Description: pank3 complex with compound pz-2891

PDB Compounds: (A:) Pantothenate kinase 3

SCOPe Domain Sequences for d6b3va1:

Sequence, based on SEQRES records:

>d6b3va1 c.55.1.0 (A:12-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlelk
dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl
hlhkldeldclvkgllyidsvsfng

Sequence, based on observed residues (ATOM records):

>d6b3va1 c.55.1.0 (A:12-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlelk
dltlfgrrgnlhfirfptqdlptfiqmgrdtvlcatgggaykfekdfrtignlhlhklde
ldclvkgllyidsvsfng

Timeline for d6b3va1:

• d6b3va1 first appeared in SCOPe 2.07