Lineage for d1dbqb_ (1dbq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143894Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 2143895Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 2143897Domain d1dbqb_: 1dbq B: [35667]
    complexed with mg

Details for d1dbqb_

PDB Entry: 1dbq (more details), 2.2 Å

PDB Description: dna-binding regulatory protein
PDB Compounds: (B:) purine repressor

SCOPe Domain Sequences for d1dbqb_:

Sequence, based on SEQRES records: (download)

>d1dbqb_ c.93.1.1 (B:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
eigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphr
ptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslge
tafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr

Sequence, based on observed residues (ATOM records): (download)

>d1dbqb_ c.93.1.1 (B:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
ldrivnkreepqsievhprlierrsvadgpfrdyrr

SCOPe Domain Coordinates for d1dbqb_:

Click to download the PDB-style file with coordinates for d1dbqb_.
(The format of our PDB-style files is described here.)

Timeline for d1dbqb_: