Lineage for d1dbqa_ (1dbq A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75160Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 75161Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 75162Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 75246Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 75247Species Escherichia coli [TaxId:562] [53836] (20 PDB entries)
  8. 75248Domain d1dbqa_: 1dbq A: [35666]

Details for d1dbqa_

PDB Entry: 1dbq (more details), 2.2 Å

PDB Description: dna-binding regulatory protein

SCOP Domain Sequences for d1dbqa_:

Sequence, based on SEQRES records: (download)

>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli}
ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
eigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphr
ptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslge
tafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr

Sequence, based on observed residues (ATOM records): (download)

>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli}
ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
ldrivnkreepqsievhprlierrsvadgpfrdyrr

SCOP Domain Coordinates for d1dbqa_:

Click to download the PDB-style file with coordinates for d1dbqa_.
(The format of our PDB-style files is described here.)

Timeline for d1dbqa_: