Lineage for d6dlxb2 (6dlx B:285-494)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. Protein automated matches [190304] (16 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [187113] (3 PDB entries)
  8. Domain d6dlxb2: 6dlx B:285-494 [356658]
    Other proteins in same PDB: d6dlxa1, d6dlxa3, d6dlxb1, d6dlxb3
    automated match to d2qy9a2
    complexed with gxy, nh4, peg

Details for d6dlxb2

PDB Entry: 6dlx (more details), 1.85 Å

PDB Description: ftsy-ng domain bound to fragment 3.
PDB Compounds: (B:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d6dlxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dlxb2 c.37.1.10 (B:285-494) automated matches {Escherichia coli [TaxId: 562]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfa

SCOPe Domain Coordinates for d6dlxb2 are not available.

Timeline for d6dlxb2:

Domains from same chain:
(mouse over for more information)
d6dlxb1, d6dlxb3
Domains from other chains:
(mouse over for more information)
d6dlxa1, d6dlxa2, d6dlxa3