Lineage for d1qnla_ (1qnl A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161452Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)
  7. 2161453Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)
  8. 2161457Domain d1qnla_: 1qnl A: [35665]
    complexed with bmd

Details for d1qnla_

PDB Entry: 1qnl (more details), 2.7 Å

PDB Description: amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide
PDB Compounds: (A:) aliphatic amidase expression-regulating protein

SCOPe Domain Sequences for d1qnla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnla_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]}
pligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlca
edfirnrgvrflvgcymshtrkavmpvveradallcypnpyegfeyspnivyggpapnqn
saplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddlq
raveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdva
egqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnwr
vedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpyv
vvhnlddw

SCOPe Domain Coordinates for d1qnla_:

Click to download the PDB-style file with coordinates for d1qnla_.
(The format of our PDB-style files is described here.)

Timeline for d1qnla_: