Lineage for d1qo0b_ (1qo0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520310Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)
  7. 2520311Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)
  8. 2520314Domain d1qo0b_: 1qo0 B: [35664]
    Other proteins in same PDB: d1qo0d_, d1qo0e_
    complexed with bmd

Details for d1qo0b_

PDB Entry: 1qo0 (more details), 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.
PDB Compounds: (B:) amic

SCOPe Domain Sequences for d1qo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo0b_ c.93.1.1 (B:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]}
rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
vvvhnlddwsasmg

SCOPe Domain Coordinates for d1qo0b_:

Click to download the PDB-style file with coordinates for d1qo0b_.
(The format of our PDB-style files is described here.)

Timeline for d1qo0b_: