![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
![]() | Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries) |
![]() | Domain d1qo0b_: 1qo0 B: [35664] Other proteins in same PDB: d1qo0d_, d1qo0e_ complexed with bmd |
PDB Entry: 1qo0 (more details), 2.25 Å
SCOPe Domain Sequences for d1qo0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo0b_ c.93.1.1 (B:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy vvvhnlddwsasmg
Timeline for d1qo0b_: