SCOP 1.59: Domain d1qo0b_: 1qo0 B:

Lineage for d1qo0b_ (1qo0 B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)

6. Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)

8. Domain d1qo0b_: 1qo0 B: [35664]
   Other proteins in same PDB: d1qo0d_, d1qo0e_

Details for d1qo0b_

PDB Entry: 1qo0, 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.

SCOP Domain Sequences for d1qo0b_:

Sequence; same for both SEQRES and ATOM records:

>d1qo0b_ c.93.1.1 (B:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa}
rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
vvvhnlddwsasmg

Timeline for d1qo0b_:

• d1qo0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo0b_ appears in SCOP 1.57
  
• d1qo0b_ appears in SCOP 1.61
  
• d1qo0b_ appears in the current release, SCOPe 2.08