Lineage for d1qo0b_ (1qo0 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75160Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 75161Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 75162Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 75163Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)
  7. 75164Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)
  8. 75167Domain d1qo0b_: 1qo0 B: [35664]
    Other proteins in same PDB: d1qo0d_, d1qo0e_

Details for d1qo0b_

PDB Entry: 1qo0 (more details), 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.

SCOP Domain Sequences for d1qo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo0b_ c.93.1.1 (B:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa}
rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
vvvhnlddwsasmg

SCOP Domain Coordinates for d1qo0b_:

Click to download the PDB-style file with coordinates for d1qo0b_.
(The format of our PDB-style files is described here.)

Timeline for d1qo0b_: