Lineage for d6fqxd1 (6fqx D:1-175)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848010Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries)
  8. 2848040Domain d6fqxd1: 6fqx D:1-175 [356633]
    Other proteins in same PDB: d6fqxa2, d6fqxb2, d6fqxc2, d6fqxd2, d6fqxe2, d6fqxf2, d6fqxg2, d6fqxh2
    automated match to d2iz1a1
    complexed with ae3, gol, peg, pge

Details for d6fqxd1

PDB Entry: 6fqx (more details), 2.8 Å

PDB Description: plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate
PDB Compounds: (D:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d6fqxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fqxd1 c.2.1.0 (D:1-175) automated matches {Plasmodium falciparum [TaxId: 36329]}
mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpg

SCOPe Domain Coordinates for d6fqxd1:

Click to download the PDB-style file with coordinates for d6fqxd1.
(The format of our PDB-style files is described here.)

Timeline for d6fqxd1: