Lineage for d1qo0a_ (1qo0 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28025Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)
  7. 28026Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)
  8. 28028Domain d1qo0a_: 1qo0 A: [35663]
    Other proteins in same PDB: d1qo0d_, d1qo0e_

Details for d1qo0a_

PDB Entry: 1qo0 (more details), 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.

SCOP Domain Sequences for d1qo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa}
rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
vvvhnlddwsasm

SCOP Domain Coordinates for d1qo0a_:

Click to download the PDB-style file with coordinates for d1qo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qo0a_: