Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (11 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Escherichia coli [TaxId:562] [50450] (9 PDB entries) Uniprot P02990 |
Domain d6ezea2: 6eze A:205-296 [356622] Other proteins in same PDB: d6ezea1, d6ezea3, d6ezeb1, d6ezeb3 automated match to d1dg1g1 complexed with gnp, gol, mg, peg, so4 |
PDB Entry: 6eze (more details), 2.47 Å
SCOPe Domain Sequences for d6ezea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ezea2 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d6ezea2: