SCOPe 2.06: Domain d1peaa_: 1pea A:

Lineage for d1peaa_ (1pea A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)

8. Domain d1peaa_: 1pea A: [35662]
   complexed with acm

Details for d1peaa_

PDB Entry: 1pea, 2.1 Å

PDB Description: amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with acetamide

PDB Compounds: (A:) amidase operon

SCOPe Domain Sequences for d1peaa_:

Sequence; same for both SEQRES and ATOM records:

>d1peaa_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]}
pligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlca
edfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnqn
saplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddlq
raveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdva
egqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnwr
vedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpyv
vvhnlddw

Timeline for d1peaa_:

• d1peaa_ first appeared (with stable ids) in SCOP 1.55, called d1pea__
  
• d1peaa_ appears in SCOPe 2.05
  
• d1peaa_ appears in SCOPe 2.07
  
• d1peaa_ appears in the current release, SCOPe 2.08