SCOP 1.57: Domain d1pea__: 1pea -

Lineage for d1pea__ (1pea -)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)

6. Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)

8. Domain d1pea__: 1pea - [35662]

Details for d1pea__

PDB Entry: 1pea, 2.1 Å

PDB Description: amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with acetamide

SCOP Domain Sequences for d1pea__:

Sequence; same for both SEQRES and ATOM records:

>d1pea__ c.93.1.1 (-) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa}
pligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlca
edfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnqn
saplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddlq
raveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdva
egqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnwr
vedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpyv
vvhnlddw

Timeline for d1pea__:

• d1pea__ first appeared (with stable ids) in SCOP 1.55
  
• d1pea__ appears in SCOP 1.59
  
• d1pea__ appears in the current release, SCOPe 2.08, called d1peaa_