SCOPe 2.07: Domain d6ezeb3: 6eze B:297-393

Lineage for d6ezeb3 (6eze B:297-393)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (9 PDB entries)
   Uniprot P02990

8. Domain d6ezeb3: 6eze B:297-393 [356606]
   Other proteins in same PDB: d6ezea1, d6ezea2, d6ezeb1, d6ezeb2
   automated match to d1dg1g2
   complexed with gnp, gol, mg, peg, so4

Details for d6ezeb3

PDB Entry: 6eze, 2.47 Å

PDB Description: the open conformation of e.coli elongation factor tu in complex with gdpnp.

PDB Compounds: (B:) Elongation factor Tu 2

SCOPe Domain Sequences for d6ezeb3:

Sequence; same for both SEQRES and ATOM records:

>d6ezeb3 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

Timeline for d6ezeb3:

• d6ezeb3 is new in SCOPe 2.07-stable
  
• d6ezeb3 appears in the current release, SCOPe 2.08