Lineage for d1gcga_ (1gcg A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390243Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1390244Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1390245Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1390274Protein Galactose/glucose-binding protein [53830] (2 species)
  7. 1390285Species Salmonella typhimurium, strain lt2 [TaxId:90371] [53832] (4 PDB entries)
  8. 1390289Domain d1gcga_: 1gcg A: [35660]
    complexed with ca

Details for d1gcga_

PDB Entry: 1gcg (more details), 1.9 Å

PDB Description: the 1.9 angstroms x-ray structure of a closed unliganded form of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium
PDB Compounds: (A:) galactose/glucose-binding protein

SCOPe Domain Sequences for d1gcga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcga_ c.93.1.1 (A:) Galactose/glucose-binding protein {Salmonella typhimurium, strain lt2 [TaxId: 90371]}
adtrigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgv
kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqg
dliakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldt
amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpe
alalvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdk
dnlseftqk

SCOPe Domain Coordinates for d1gcga_:

Click to download the PDB-style file with coordinates for d1gcga_.
(The format of our PDB-style files is described here.)

Timeline for d1gcga_: