Lineage for d5zgrb_ (5zgr B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (31 species)
    not a true protein
  7. 2556016Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 3056534Domain d5zgrb_: 5zgr B: [356596]
    automated match to d4eyba_
    complexed with gol, zn, zz7

Details for d5zgrb_

PDB Entry: 5zgr (more details), 1.15 Å

PDB Description: crystal structure of ndm-1 at ph7.3 (hepes) in complex with hydrolyzed ampicillin
PDB Compounds: (B:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5zgrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zgrb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

SCOPe Domain Coordinates for d5zgrb_:

Click to download the PDB-style file with coordinates for d5zgrb_.
(The format of our PDB-style files is described here.)

Timeline for d5zgrb_:

  • d5zgrb_ is new in SCOPe 2.07-stable