Lineage for d1gca__ (1gca -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28046Protein Galactose/glucose-binding protein [53830] (2 species)
  7. 28050Species Salmonella typhimurium, strain lt2 [TaxId:90371] [53832] (3 PDB entries)
  8. 28051Domain d1gca__: 1gca - [35659]

Details for d1gca__

PDB Entry: 1gca (more details), 1.7 Å

PDB Description: the 1.7 angstroms refined x-ray structure of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium

SCOP Domain Sequences for d1gca__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gca__ c.93.1.1 (-) Galactose/glucose-binding protein {Salmonella typhimurium, strain lt2}
adtrigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgv
kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqg
dliakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldt
amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpe
alalvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdk
dnlseftqk

SCOP Domain Coordinates for d1gca__:

Click to download the PDB-style file with coordinates for d1gca__.
(The format of our PDB-style files is described here.)

Timeline for d1gca__: