SCOPe 2.07: Domain d5ysza2: 5ysz A:64-340

Lineage for d5ysza2 (5ysz A:64-340)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (76 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:269800] [356586] (1 PDB entry)

8. Domain d5ysza2: 5ysz A:64-340 [356587]
   Other proteins in same PDB: d5ysza1
   automated match to d2jcga2
   complexed with cbi, gol

Details for d5ysza2

PDB Entry: 5ysz, 1.63 Å

PDB Description: transcriptional regulator celr-cellobiose complex

PDB Compounds: (A:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d5ysza2:

Sequence; same for both SEQRES and ATOM records:

>d5ysza2 c.93.1.0 (A:64-340) automated matches {Thermobifida fusca [TaxId: 269800]}
tdtvalvvsennqklfaepfyagivlgvgvalsergfqfvlatgrsgieherlggylagq
hvdgvlllslhrddplpqmldeagvpyvyggrplgvpeeqvsyvdidnigggrqatqrli
etghrriatiagpqdmvagverlqgyreallaagmeydetlvsygdftydsgvaamrell
drapdvdavfaasdlmglaalrvlrasgrrvpedvavvgyddstvaehaeppmtsvnqpt
elmgremarllvdritgettepvrlvlethlmvresg

Timeline for d5ysza2:

• d5ysza2 is new in SCOPe 2.07-stable
  
• d5ysza2 appears in the current release, SCOPe 2.08