Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (76 species) not a true protein |
Species Thermobifida fusca [TaxId:269800] [356586] (1 PDB entry) |
Domain d5ysza2: 5ysz A:64-340 [356587] Other proteins in same PDB: d5ysza1 automated match to d2jcga2 complexed with cbi, gol |
PDB Entry: 5ysz (more details), 1.63 Å
SCOPe Domain Sequences for d5ysza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ysza2 c.93.1.0 (A:64-340) automated matches {Thermobifida fusca [TaxId: 269800]} tdtvalvvsennqklfaepfyagivlgvgvalsergfqfvlatgrsgieherlggylagq hvdgvlllslhrddplpqmldeagvpyvyggrplgvpeeqvsyvdidnigggrqatqrli etghrriatiagpqdmvagverlqgyreallaagmeydetlvsygdftydsgvaamrell drapdvdavfaasdlmglaalrvlrasgrrvpedvavvgyddstvaehaeppmtsvnqpt elmgremarllvdritgettepvrlvlethlmvresg
Timeline for d5ysza2: