Lineage for d5ysza2 (5ysz A:64-340)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. Protein automated matches [190646] (77 species)
    not a true protein
  7. Species Thermobifida fusca [TaxId:269800] [356586] (1 PDB entry)
  8. Domain d5ysza2: 5ysz A:64-340 [356587]
    Other proteins in same PDB: d5ysza1
    automated match to d2jcga2
    complexed with gol

Details for d5ysza2

PDB Entry: 5ysz (more details), 1.6300000000000001 Å

PDB Description: transcriptional regulator celr-cellobiose complex
PDB Compounds: (A:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d5ysza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysza2 c.93.1.0 (A:64-340) automated matches {Thermobifida fusca [TaxId: 269800]}
tdtvalvvsennqklfaepfyagivlgvgvalsergfqfvlatgrsgieherlggylagq
hvdgvlllslhrddplpqmldeagvpyvyggrplgvpeeqvsyvdidnigggrqatqrli
etghrriatiagpqdmvagverlqgyreallaagmeydetlvsygdftydsgvaamrell
drapdvdavfaasdlmglaalrvlrasgrrvpedvavvgyddstvaehaeppmtsvnqpt
elmgremarllvdritgettepvrlvlethlmvresg

SCOPe Domain Coordinates for d5ysza2 are not available.

Timeline for d5ysza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ysza1