SCOPe 2.07: Domain d5ysza1: 5ysz A:6-63

Lineage for d5ysza1 (5ysz A:6-63)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (17 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:269800] [356584] (1 PDB entry)

8. Domain d5ysza1: 5ysz A:6-63 [356585]
   Other proteins in same PDB: d5ysza2
   automated match to d1zvva1
   complexed with cbi, gol

Details for d5ysza1

PDB Entry: 5ysz, 1.63 Å

PDB Description: transcriptional regulator celr-cellobiose complex

PDB Compounds: (A:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d5ysza1:

Sequence, based on SEQRES records:

>d5ysza1 a.35.1.0 (A:6-63) automated matches {Thermobifida fusca [TaxId: 269800]}
rptlemvaalagvgrgtvsrvingsdqvspatreavkraikelgyvpnraartlvtrr

Sequence, based on observed residues (ATOM records):

>d5ysza1 a.35.1.0 (A:6-63) automated matches {Thermobifida fusca [TaxId: 269800]}
rptlemvaalagvgrgtvsrvingsdqvspatreavkraikelgyvpnrr

Timeline for d5ysza1:

• d5ysza1 is new in SCOPe 2.07-stable
  
• d5ysza1 appears in the current release, SCOPe 2.08