Class a: All alpha proteins [46456] (289 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (17 species) not a true protein |
Species Thermobifida fusca [TaxId:269800] [356584] (1 PDB entry) |
Domain d5ysza1: 5ysz A:6-63 [356585] Other proteins in same PDB: d5ysza2 automated match to d1zvva1 complexed with cbi, gol |
PDB Entry: 5ysz (more details), 1.63 Å
SCOPe Domain Sequences for d5ysza1:
Sequence, based on SEQRES records: (download)
>d5ysza1 a.35.1.0 (A:6-63) automated matches {Thermobifida fusca [TaxId: 269800]} rptlemvaalagvgrgtvsrvingsdqvspatreavkraikelgyvpnraartlvtrr
>d5ysza1 a.35.1.0 (A:6-63) automated matches {Thermobifida fusca [TaxId: 269800]} rptlemvaalagvgrgtvsrvingsdqvspatreavkraikelgyvpnrr
Timeline for d5ysza1: