Lineage for d5ysza1 (5ysz A:6-63)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. Protein automated matches [190907] (21 species)
    not a true protein
  7. Species Thermobifida fusca [TaxId:269800] [356584] (1 PDB entry)
  8. Domain d5ysza1: 5ysz A:6-63 [356585]
    Other proteins in same PDB: d5ysza2
    automated match to d1zvva1
    complexed with gol

Details for d5ysza1

PDB Entry: 5ysz (more details), 1.6300000000000001 Å

PDB Description: transcriptional regulator celr-cellobiose complex
PDB Compounds: (A:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d5ysza1:

Sequence, based on SEQRES records: (download)

>d5ysza1 a.35.1.0 (A:6-63) automated matches {Thermobifida fusca [TaxId: 269800]}
rptlemvaalagvgrgtvsrvingsdqvspatreavkraikelgyvpnraartlvtrr

Sequence, based on observed residues (ATOM records): (download)

>d5ysza1 a.35.1.0 (A:6-63) automated matches {Thermobifida fusca [TaxId: 269800]}
rptlemvaalagvgrgtvsrvingsdqvspatreavkraikelgyvpnrr

SCOPe Domain Coordinates for d5ysza1 are not available.

Timeline for d5ysza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ysza2